I want a phrase for "to make a wish" instead of a single verb "to wish", in order to make the line of lyrics long enough for the music. The noun for "wish" may be optatum, but I didn't find a word for "to make", and dictionaries don't show this collocation. Are there existent usages of this const...

Asteroid 99942 Apophis is due to pass close to the Earth in 2029, at a distance of slightly less than 40,000 Kilometres. According to the description we have, the shape is irregular and elongated. It is probably formed by several objects loosely held together by a small gravity. So I wondered if ...

So there is a challenge, lets say we have a selection and sub-selection, when few items in sub-selection menu it looks great(image 1), but problem occurs when many ( image 2 ) I drafted solution in image 2, but I think its not good at all Remark: - changing to vertical menu is not an option - scr...

I need to create a couple of bar charts, and I'm using the BarChart built-in function. Currently, I have managed to make them look like the image on the left. BarChart[Range[5], BarSpacing -> None, AspectRatio -> {1, 1}] However, I would like to add the inner squares to each bar on the chart (a...

A PCB that I am working on has a non-plated hole into which a press-fit threaded insert is installed to provide the mounting point for an M.2 SSD. As such, when the SSD is installed, the mounting screw is not electrically connected to the PCB. A colleague mentioned that the SSD itself uses a plat...

I'm struggling to find the title of this book I read a few times growing up and really enjoyed. Main character, pretty sure is named Ghendt, is in the Stone age, hunting, and comes across a tower. Inside he meets some sort of divine force that starts training him. I think it takes the form of a c...

In this anime, a girl dreams about another world. One day, a boy from the other world came into her room and asked for help because his world was falling apart. He's like some sort of royal in his world. All I remember is that they had to work together to fight. Also, the world is on top of their...

I've only ever found vague instructions, e.g. failing to mention how much chili (dry or fresh?) should be extracted in how much ethanol. How about a soxhlet extraction? Then dilute the extract with sugar water till it's no longer spicy. I think it's crucial to let the panel of tasters start with ...

In the ninth volume ("Biografias") of the Colombian encyclopedia "Gran Enciclopedia de Colombia" there is a biography of the Colombian author Fanny Buitrago. It can be read here (pages 96-7, in Spanish). It is attributed to Letty Buitrago, so someone of the same surname. I'd like to know whether ...

According to Wiki: The Church Fathers, Early Church Fathers, Christian Fathers, or Fathers of the Church were ancient and influential Christian theologians and writers who established the intellectual and doctrinal foundations of Christianity. The historical period in which they worked became kn...

We had a very big hail storm last night and the hailstones were between golf ball and tennis ball sizes. Fortunately, there weren't a ton of them, they were just huge. I'm in a position of not knowing the best course of action on how to get some large dents repaired. While I expect a specialist w...

I know this type of question has been addressed before, but I believe mine is slightly different and hints at a potential misunderstanding I've had for a long time. I understand the concept of equilibrium vapor pressure, that molecules with high enough energies escape the surface of a liquid unti...

As a single adult male I tend to eat my fair share of microwave ready meals, and they all say the same thing: pierce the protective plastic cover before heating at %POWER%, usually around 800W for %TIME%, usually 4-5 minutes. Most of them say to use a fork to make around half a dozen holes in the...

I would like to get access to the Chromium cookies on the command line -- externally to chrome and without the use of any extensions. Where does Chromium store the cookies on disk? Is this possible and how would I go about doing it? I have an external utility that wants to authenticate with a coo...

Whenever I select anything it just shows the shader thing at the bottom of the screen. I am in object mode in layout and I can't do anything or move anything! not sure what to do. Here is the scene I downloaded. https://open3dlab.com/project/34717/

I have a situation where I need to maintain the same IP address and/or hostname between two network interfaces on several macOS laptops: the ethernet and wifi. The topology is such that there is a pfSense router serving DHCP and DNS resolving services for the network. Currently the ethernet inter...

Most of the military personnel seem to have the number 37 on their collars. What does this number mean? Where does it come from?

In 学校から帰ってきて寝るまでくらいだ I was under the impression that くらい is an adverbial particle (副助詞), but here it's acting as a noun (名詞)? Can it also function as a noun, or is there an implicit noun after くらい and before だ that's being colloquially dropped (maybe something like 時間)? Here's my rough transl...

Many AOE spells use a point as their origin, and from this point, area is calculated. Faerie Fire doesn't state where spells start. Often, AOE spells are cast in rooms near walls to avoid friendly fire, so part of the spell is negated by the wall, and friendly creatures are safe. Can Faerie Fire ...

This is a word division puzzle which uses cryptic clues. If you're unfamiliar with either or both of those, you can click the associated link. In order to solve the alphametic, you'll first need to fill in the dividend, divisor, and quotient by solving the cryptic clues. I've left the enumeratio...

The deepest mythological archetypes in my Earth-like world hint at a wondrous and terrible disaster in the ancient past. ~10 tya a celestial body (perhaps a small, second moon, or a wandering asteroid, either suits) broke apart in the sky, well in sight of my primitive humanoids, and formed a bea...

I ran the following commands to setup extended event captures for blocked processes: CREATE EVENT SESSION [blocked_process] ON SERVER ADD EVENT sqlserver.blocked_process_report( ACTION(sqlserver.client_app_name, sqlserver.client_hostname, sqlserver.database_name)) , ADD ...

According to Heb. 11:1-5 (D-R): Now faith is the substance of things to be hoped for, the evidence of things that appear not. Does the Bible offer what may be considered to be a definition of faith elsewhere in either the New Testament or the Old Testament?

I recently purchased a jet dust collector which is 230v motor 15amps. However, its plug is the regular 3 prong plug. In my garage, I have a separate 250v outlet with 20amps circuit breaker but it has the lockturn outlet. Is there a way to convert this 3 prong plug to the turnlock using an adapter...

My faucet nut has very littl edge to work with. Please help (see picture for clarification). The nut size is slightly smaller than 1 inch. My 1 inch socket couldn't loosen it.

Following up on this question, can someone help me clear up the notation we're using for states in Shor's algorithm? It's very unclear what the sentence "where the second register is $|1\rangle$ made from $n$ qubits" in the Wikipedia article means. The input state is supposedly $|0\rangle^{\otim...

My understanding of radiation is that is travels in a straight line. So a basement buried on three walls with no windows is a great shelter because you have thick dirt on three sides. but the radio active dust landing on the roof is still radiating right through the wood of the house (1 story) ...

Upon hearing the two characters kissed, the girl is shocked and wonders if they are going together despite being two guys, however he explains it was only because of a punishment game. ちょっと　あんた今時その感じはアレよ What is exactly the meaning of はアレよ here? My understanding is akin to "nowadays there are a...

I am struggling to find a solution to this issue. Maybe there is none. I am seeking a way to decrease variance as character skill advances. I've considered various mechanisms for dice tests. I have one in particular that does not accomplish this by default, but I like the mechanism for other reas...

I am writing a dissertation and I need it to be in two languages (English and Spanish). The organization is as follows: Table of contents Preface and Abstract appear in both languages Body of the dissertation: first, all the chapters appear in english (in part 1) and then all the chapters in Spa...

I read that it might be possible but I am wondering can I actually see small flames jetting from the surface around the circumference of the eclipse assuming they are active at the time? There is a total solar eclipse in 2024 that I will be able to see. I have binoculars and since I will have ab...

I have a 2002 Nissan Maxima which which started exhibiting a number of transmission issues shortly before and during a 2,600 mile road trip across the country, and is still experiencing these problems; the issues displayed are as follows: Two DTCs are stored in the PCM - P1574 "(ACSD) Vehicle Sp...

Alice and Bob play the game - the rules of the game are not important, and after 8 rounds Alice has 5 points and Bob has 3 points. Every round one of 2 players gets 1 point and the winner of the game is the one who gets 6 points first. What is expected probability of Alice winning the game consid...

I feel like it would make more sense to use 五 since it literally means 5. I know that 正 has 5 strokes and 五 has 4, but you could still tally like so: I also know this question isn't just limited to Japanese, but since I'm learning that and not the other languages that tally this way, I thought I...

I am applying for a B1/B2 US visa and filling out the DS160 form. I had a US visa before, but am unsure about the following question regarding my previous visa: "Are you applying in the same country or location where the visa above was issued, and is this country or location your place of princip...

\FPeval returns a multiple values error when using ceil or floor, but not trunc or round. \documentclass{article} \usepackage{graphicx} % Required for inserting images \usepackage{fp} \begin{document} \newcommand{\first}{78} \newcommand{\second}{12} \FPeval{\result}{ceil(\first / \second, 2)} ...

One question and AI-generated response per answer, communty wiki flag and an explanation of why the AI response is wrong would be encouraged. The AI program does can optionally be identified. I think this is likely to be useful and educational - not just entertaining.

I see this image everywhere but can’t figure out where it is.

I'm new to manifolds and in my Computer Graphics class, we briefly explored the topic superficially through visual examples. From my intuitive understanding, we should be able to place a Euclidean grid on a manifold's surface or it should appear flat locally. However, I'm puzzled by how a pyramid...

Goal I want to draw both an UTM coordinate grid as well as a geographic coordinates grid (lat, lon) on a map in the QGIS print layout window as shown here. Setup GeoTIFF layers with tfw files as .zip archives downloaded from here. Add layer to project (still default project CRS EPSG:4326 as laye...

Consider a topological space $(X,\mathcal{T})$, and a sequence of sets $(K_n)_{n\in\omega}$, such that $(\forall n\in\omega)(K_n\text{ is compact})$, and $(\forall m<n)(K_m\supset K_n)$. Is it true that $\cap_{n\in\omega}K_n\neq\emptyset$?

I baked particles in Blender, but they don't show up in renders when I select the "Emitter" option. When I attempted to Render Image and Render Animation, I couldn't see the particles. Although they were baked, they appear as squares instead of circles (emitter). I've made several attempts to del...

Can you identify the author/title of a big sprawling sci fi thriller in which an American astronaut recovers a small alien object in earth’s orbit? The object turns out to be an interstellar probe, one of many. Another character, a man from China or Hong Kong, is salvaging more of these probes fr...

I am trying to get to a sed command to format(html) the first two letters of every word from a plaintext input. I would like to input a plain text and mark the first two letters bold with the <b> tag to form an html file representing the same text but with formatting to look something like this: ...

Let us suppose we have an infinite number if Bernoulli variables that can take one of two values: $-1,1$, with equal probability. Then their sum converges to a normal probability distribution. What about variables that can take three values, $-1,0,1$ with equal probability? Does the probability d...

I recently got typed in the CL-65 and received my restricted ATP certification. I can’t figure out why but apparently due to the amount of limitations such as PIC in accordance with 61.167 and vmc circle only and Cl-65 vmc circle only lines, they added the rest onto a second plastic certificate. ...

The question in the title; if there is no existent precluding factor (whatsoever) for the existence of some x, must such a x exist?

Couldn't we just assume that waves have mass and momentum and can become localized? Dirac Deltas can be given a rigorous mathematical foundation but physicist do not use the Gelfand triple. Why not just assume that electrons, photons, etc., have the same dimension as space? I know string theory d...

I need to store a public key in a variable of maximum 32 bytes. I recover the compressed key and remove its prefix, but then I have to do the opposite: I have to rebuild the compressed address from it without the prefix. I know that the prefix depends on the last two characters of the uncompresse...

What do lowercase letter "a"s mean in guitar tabs?

What determines when a criminal case’s sentencing remarks are available publicly or even exist in written form in the first place?

What should I do to expand my knowledge so that I don't get stuck with such amateur questions in the future? :) I am more inclined towards an articled option, 'cause I believe we can count delays, although delays are abstract in the sense that they're not physical objects... The context is: "Your...

Let $\mathbb{k}$ be a field and $A$ be a commutative $\mathbb{k}$-algebra. Then the algebra of formal power series $A[[x]]$ can be viewed as a $\mathbb{k}[[x]]$-module in a natural way. My question is whether $A[[x]]$ is a free $\mathbb{k}[[x]]$-module. Note that $\mathbb{k}[[x]]$ is a P.I.D. and...

During the conflict between David and Shaul, David inquired of God (perhaps via the urim v'tummim) as to how to behave (where he should go, what he should do etc.). However, when his son Avshalom rebels David does not make any inquiries, instead he leave Yerushalayim and does not seem to seek the...

One definition I encountered was something that is either true or false. (for example, I ate vegetables yesterday is a proposition). Another definition I encountered is the meaning of a sentence (for example snow is white in English and snow is white in Spanish are the same proposition). So which...

Let $X$ be a topological space and $x_0 \in X.$ Consider the based path space $$\mathcal P_{x_0} (X) : = \left \{\gamma : [0,1] \xrightarrow{\text {continuous}} X\ \bigg |\ \gamma (0) = x_0 \right \}$$ of $X$ at $x_0$ equipped with the compact open topology. Then we get a deformation retract $H :...

I asked the question in Math StackExchange. Link: https://math.stackexchange.com/questions/4765476/approximation-of-partial-sum-over-prime-omega-function I haven't got any response yet. Here are the details: The prime omega function $\omega(n)$ counts the number of distinct prime factors of a nat...

I'm working in a codebase at work that requires that anyone who wants to merge a PR rebase against the last master prior to merging the pull request. To further complicate things, CI (which takes hours) has to pass before the PR can be merged, so if someone merges a commit to master while CI is r...

I'm trying to make this honeycomb pattern in Geometry Nodes in a way that I could just click some integer higher and by so construct the honeycomb from center to outwards, so that it would keep the round shape as much as possible. Like this, but perfect honeycomb: It doesn't have to grow three h...

I was having a conversation with my father who used to be a photographer and I said “when I open a raw file…..” He interrupted me and said, you can never open a raw file, the editing software simply creates a “preview” of the raw file. I told him, since the invention of “raw editors” like Lightro...

I have the following code: uint8_t buffer[16]; uint8_t data[16]; uint8_t buffer_length = 16; uint8_t data_length = 0; memcpy(buffer + buffer_length, data, data_length); memcpy should be a no-op, because data_length is zero. However buffer + buffer_length points just outside of the allocated mem...

Forest gnomes have the following racial feature: Speak with Small Beasts. Through sound and gestures, you may communicate simple ideas with Small or smaller beasts. Like many words in English, "communicate" has different senses with differing definitions. In fact, the Oxford English Dictionary ...

Me and my friends were chatting in dinner in California. Some were complaining about the high sales tax rate in our state. One suggested that if any of us had an Oregon address, we could have our stuff shipped there, then shipped to our residences so that we could take advantage of Oregon's 0% sa...

On Google Flights, if I search for a one way ticket to Tokyo on November 1st: From NLU: 91K MXN From MEX: 15K MXN The cheapest options in both cases have multiple stopovers. Given that there are flights to big airports like Houston from NLU, why is the price difference so big? I'd be able to ge...

I wanted to do add some graphics to a document in a way that thay are rotated ramdomly. For this this purpose I tried the following code \documentclass[ngerman,german,14pt,twoside,openany]{scrbook} \usepackage[left=2.5cm,right=2.5cm,top=2cm,bottom=2.5cm]{geometry} \usepackage[ngerman]{babel} \us...

In the diagram below $AD\equiv BC$ and $\alpha + \beta=180^{\circ}$. Find the measure of $\theta$. I'm given a hint: First extend $DC$ past $C$ to the point $E$ where $CE \equiv AB$, then draw $AE$ and look for congruent triangles. So I did extend the figure and I get something like this: Now $...

So a lot of 'proofs' of Faraday's use the third of the Maxwell's equations $\nabla \times \bf {E} = -\dfrac {\partial B}{\partial \it t}$ to simplify the flux integral by first splitting it into two integrals. One for the time-dependent magnetic field and one for the change in flux when the surfa...

Currently, I am building a simple Z80 computer system on breadboard. I am at the point where I need to start learning how the display module works so that I can have some output. I cannot for the life of me get the display to show anything, no matter what bytes I send to it. Below is the ASM code...

I currently have a chart as follows: As you can see, I have three 'value' columns per X-axis item represented by the colours blue, orange and grey. I also have three 'count' lines represented by the colours yellow, light-blue and green. What I need is for the three lines to be merged into a sing...

After many years of doing medical research it is very clear to me that the vast, vast majority of what we create in terms of research is utter gargabe, and it is so a priori, ie we know it before we publish. There are hundreds of meta research papers on this topic, including the Lancet series “Re...

Eve, as a practical joke, asks Mark to go to a place she describes as a “public park” to fetch a hat she had supposedly left behind. Unbeknownst to Mark (but beknownst to Eve) the area is actually an unmarked Wild Turtle preserve. A law criminalises trespassing onto such a place, and the law does...

How can I find out for what values of r (both lower and upper limits), is this integral convergent/divergent? I = Integrate[(1/r^2)*BesselJ[0, (m/R0)*r]*D[BesselJ[0, (m/R0)*r], {r, 2}], {r, ?, R0}] Here m is the root of BesselJ[1, m] == 0

Today humanity is in the richest state that it has ever been in. Do you consider that correct here? Can it be substituted for than? I think that would be wrong, but logically it fits in here. I can't spot an entry in a dictionary which conveys the meaning which that conveys in my sentence.

I am presenting my use case here. Let's think of a dating app where each candidate enters their preferences and we store their data and add them to an array. when someone enters that matches with any of the persons in order and they become partners we remove the person from the array. I have seen...

Here's some things I kept in my basement for a while. a scroll a flower pot a vase a bust of a woman's head a ballerina dress a blank canvas Weirdly, these are the only things I can remember. By this information, what musician was I listening to? (7, 5, 5)

It is well known that copper sulfate, sodium sulfate, et al crystallize with 5,10 water molecules of hydration, locked in their crystal lattices. Is it possible to have other molecules instead of water, such as maybe ammonia or hydrogen sulfide?

I can remember two short stories, and while I am not entirely sure if they're from the same book, I would hugely appreciate finding either. The first story I remember reading about was about a girl and her father starving during a harsh winter. It opened with the girl pulling up a floorboard and ...

Can we pinpoint in what year the number of IBM-compatible PCs (whether original IBM machines or clones) sold without a hard disk drive became so negligible that almost all new commercial software, even games, started requiring a hard disk to function? I would assume that it was around 1990, but i...

I sowed a new lawn 1-2 months ago. It grows more than twice as fast as the old lawn. I never water my lawn and it gets the same amount of sun for the whole lawn. No fertiliser either. However, there is a big difference in the speed of growth, it looks a bit strange. The seed is not the same, I di...

I have an SQLite DB, let's assume the id can be considered as the order of rows, I want to find repeating sequences in the table according to certain criteria. consider this example (http://sqlfiddle.com/#!5/dbdb0/1) schema + data: CREATE TABLE eventLog ( id integer primary key autoincr...

C++ shared_ptr implemented as a coding practice and learning purposes. It uses std::shared_ptr interface. Basic tests are included (using single header Catch 2) Some methods are omitted to keep the code shorter and readable. For simplicity it's in expects C++ 20. See comments for more details. I...

I doesn't get my code fixed by the width. Latex says that I use illegal character in the array. This is my code: \begin{table}[ht!] \centering \begin{tabular}{|| c{5cm} | c{5cm} | c{5cm} | c{5cm} | c{5cm} ||} \hline Buis & Lengte (m) & Debiet (m\textsuperscript{3}/h) & Diameter (mm) & Handelsm...

This is part 12 of A Trivial Pursuit, a 25-part puzzle hunt. Each part is solvable on its own, with the exception of the meta-puzzle at the end. This is a variation on a Battleships puzzle, where the custom fleet of ships to be placed includes some that are irregularly-shaped. In the spirit of J...

At the risk of sounding crass, Sarah was advanced in years in Genesis 18, but in Genesis 20 King Abimelech took Sarah because he was apparently attracted to her. Then in Genesis 21 Abraham becomes a father at age 100. Again, at the risk of sounding crass, why would Abimelech take an old woman who...

1. Problem statement Going from right to left, I want do delete all elements after they have occured n times. The solution I found seems to work reliably, but is rather long and uses a function, DeleteElements, which was only introduced in V 13.1. 2. Current solution DeleteAbove[lis_, n_] /; n >=...

For example, in one turn, there is a Fighter that has Dual Wielding and uses Attack Action on the greatsword that was previously held. He then chose to release the one hand holding the greatsword and used Interact with object to take out the longsword. Could he still do Two Weapon Fighting?

For example: If I receive an email, I'd like to hear the word "Gmail" spoken aloud. I could use TalkBack for this, but then the entire notification is read aloud (including parts of the email's content). I want to hear just the app name. Also I'd like it to work even when TalkBack is off (I use T...

The Gemara in Nedarim 32b famously writes: ״הַשָּׂטָן״ בְּחוּשְׁבָּנֵיהּ תְּלָת מְאָה וְשִׁיתִּין וְאַרְבְּעָה The letters of the term "HaSatan" ("The Satan") is 364 in numerical value, [which equals the number of days of the year, except for Yom Kippur, during which he has no power]. And yet i...

Ruth is mentioned as a servant, Handmaid, maidservant, slave, foreigner, Moabit what I would like clarified is; The Hebrew & Greek word that are used for, servant, Handmaid, maidservant and slave? Which is the correct word that described her standing? Ruth 2:13 Holman Christian Standard Bible...

I have two rows of values that I'd like to represent as a table, where cells are diagonally divided showing color-coded values with column A and column B values for each row such as below: Any neat idea how produce such design? The hardest part for me is dividing the cells diagonally.

I am wondering if it is possible to take the binary strings of length $3$ (tuples) whose sums have weight $2$ (i.e they have $2$ non-zero entries)(binary case, meaning they have two $1$'s entries) $$u \in \text{tuples}$$ $$v \in \text{tuples}$$ $$u + v \in \text{tuples of weight } 2$$ and then re...

I am a recent graduate working on a side project that involves creating a test jig/method for a large PCB backplate. Unfortunately, the original layout and diagrams are no longer available, so I need to create a schematic and map out the connections before developing a permanent testing method. T...

I have reached an area of Turkey where hotels are few and far between, which is making it more challenging to plan my trip. I am therefore looking for new ways to find suitably located accommodation to help me plan. Is there any comprehensive online list/database of all hotels which have been awa...

I previously asked this on Mathematics Stack Exchange, to no result: Consider the standard induced inner product structure on $\wedge^k\mathbb{R}^d$ given by defining $$\langle u_1\wedge \cdots \wedge u_k, v_1\wedge \cdots \wedge v_k\rangle:=\det ([\langle u_i, v_j\rangle]_{i,j=1}^d)$$ for simple...

My daughter and her family are moving to Portugal in November on a D7 visa. They will be issued with temporary residence cards valid for two years. If they come to visit me in the UK, do they need a UK tourist visa or can they travel as EU citizens on the ETA UK Visa Waiver scheme? If they need a...

I have a conventional old-ish mountain bike front wheel - 26", 32 hole, disc brake, 100 mm over locknuts. I've been using it for road riding for years and have never trued it, but recently borrowed a wheel truing stand, so thought i would give it a look. It appears to be reasonably true laterally...

I'm trying to UpSet a certain value for the derivative of a function $Y=Y(l,m,x)$. This can be done by: D[Y[l_, m_, x_], x_] ^= (l + 1) Y[l, m, x]; D[Y[a, b, c], c] (*(1 + a) Y[a, b, c]*) But the problem is, this doesn't always work since for other types of expressions, because Mathematica uses ...

I am looking for a book or the webtoon that was based on that book. I lost my webtoon account and I can't find the title. As I remember, it was about a boy with superpowers (probably lightning) that was sent to army(?) school to practice. His nemesis was a slick Malfoy-like boy with white hair. I...

If I understood Ark correctly, pool transactions (which are on-chain transactions) are connected, as the output of pool transaction A is used as an input of the pool transaction A+1. If so, how can that work if there's this mempool policy that limits the number of ascendants/descendants on unconf...

I have an Ecoflow battery to be used in a Volkswagen Caddy and which I'd like to keep connected to the Caddy's 12V accessory port (unless the car is OFF for more 1 or 2 hours). The Caddy has the 12V accessory ports always live. The Caddy manual gives the following warning regarding 12V accessorie...

We need to declare CE compliance of a system consisting of pumps, valves, sensors and control cabinets. I am dealing with the EMC element of the certification. I have collected the manufacturer's declarations for all the components, to see if harmonized standards were used and therefore if a pres...

I have a requirement in the Salesforce flow to update a particular contact record twice. The two update elements are consecutive that is after one update it goes to the other. But I have a requirement to first commit the changes in the first one and then execute the second update. Due to Salesfor...

I have a Dell Precision 5820 tower that came with 2 NVMe SSD disks on the FlexBay (the front compartment). I have been talking to Technical Support in my country (Spain) to find out how to install a third NVMe SSD, but they have been so far unable to find a way. I am shocked that the 5820 is mark...

I know that this is a very old window opener, it has a body like espagnolette window opener except that the working principle is quite different. There are two metal bars passing by the upper and lower ends of the stadium shaped body. after inspecting, I have realized that there are 2 cylinders i...

Can a verb be made pronominal and keep the meaning of its non-pronominal form? For instance, in the following sentence, why does "hacer" keep it's meaning of "to do"? Se hacen la compra los unos a los otros. - They do one another's shopping. (The sentence and its translation are from A New Refe...

I've got a bit of a situation at hand. Out of the blue my daughter (14yo) got a chance to go on a trip to Poland (from Latvia where we live). They leave very early tomorrow morning. The trip is legit with known people and several of her friends are going too. Most expenses are paid by me through ...

Is there any mention of Kula Devi or Devata name of Shree Rama in Srimad Valmiki Ramayana?

I tried to use the TAB environment in a .dtx file with l3doc class, but It seems to make latex compilation fail. MWE: \documentclass{l3doc} \usepackage{xcolor} \usepackage{easytable} \begin{document} \begin{TAB}(e,1cm,1cm){|c|c:c:c|}{|c|c:c|} a & b & c & d \\ 1 & 2 & 3 & 4 \\ ...

Hoping to check some recurrance relationship like this $a_1 = x$ and $a_2 = y$, with $$ a_{2n+1} = a_{2n} a_{2n-1} $$ and $$ a_{2n+2} = a_{2n+1} + 4 $$ Tried a[1] = x; a[2] = y; a[2*n + 1] := a[2*n]*a[2*n - 1]; a[2*n + 2] := a[2*n + 1] + 4 Table[a[n],{n,1,10}] and RecurrenceTable[ {a[2 n...

Can anyone help me identify this IC? It's inside a Camranger 2 next to a USB and ethernet port. It's overheating.

I want to make a dummy load using IGBT. Is it possible to control the Ice (collector to emitter current) using the gate voltage? It would be really great if it is possible to explain the answer. The following are the parameters. Voltage and current need to be controlled: 85V 50A ( I want to contr...

"Pater Iūliae est Iūlius". Would this be "Julia's father is Julius", or "The father of Julia is Julius"? I feel like it's missing some words to be the latter. Does it matter? How can I tell?

I have a question about connecting APs to the main router. In the picture below there are two options. Both options are connected entirely by ethernet cable and the access points act as ethernet switches: In Option A, the modem (ISP), main router, and three APs are daisy-chained together. In ...

I came across this article by a long time contributor of this forum. In particular, the article mentioned a definition of paticca samuppada (PS) in Nyanatiloka's Buddhist Dictionary 'dependent origination', is the doctrine of the conditionality of all physical and psychical phenomena, The artic...

Installing a garage mini split with AC and heat. Running <25 ft of 12 gauge to disconnect and 10 gauge whip to condenser. Unit specs say rated for 8.7 Amp with max Amps in heat mode at 13.0 amps. Should I use a 20 Amp breaker due to the 80% breaker rule or is a 15 Amp ok because the 13.0 amps...

In the figure we are supposed to find the current in 8ohm resistor. So by using simple KVL rule I was able to figure it out to be -1.25A. But in the second approach When I calculated current in 8 ohm resistor, it turned out to be 5.25A. So which answer should I report? And why is there differen...

I read a novel as a teenager in the early 2000s about an alien invasion. What I remember is the main characters were teens, the aliens were blobs that entered people's heads, and the teens described seeing them behind their parent's eyes. Those who were taken over didn't have emotions and would c...

I have been thinking about the following question quite a bit recently: why do other languages, which often do not even use the Latin alphabet, seemingly get to decide on the way their words get Latinized in English, even if the original pronunciation of the letters chosen for their Latinization ...

This question is connected with reference to my previous question (Solution of Dimensionless Partial Differential Equation Over a Semi-Circular Domain), where I asked for a help to solve the following BVP. I would like to thank Nasser (https://mathematica.stackexchange.com/users/70/nasser) for h...

Is there a survey or some other resource that goes over commonly used methods for p-hacking in scientific literature? I can broadly think of three ways -- 1) adjusting dataset, 2) adjusting reported metric, and 3) adjusting distribution of the null hypothesis, looking for more examples. This is f...

I would like to copy the first part (IxoscaEVm****t1_, without the '.p[number]') of the line starting with ">" and paste a before the last ":" of the same line. Input: >IxoscaEVm2293881t1.p1 type:complete len:255 gc:Universal :13-219(+) MFLRQLGAPRFYYARLFLRFIAVTIGPFLKSFPEKMLFLTYFPFYFWQRFSNINKRRKLL...

I was given a Nikon Coolpix 900 (1998 model) but there was no CompactFlash memory card. Basically in so many words the original package came with a: EC-8CF 8MB CompactFlash card but now I am questioning whether or not I need that exact model (likely an eBay purchase at this point) or can I get a ...

I am a relatively new photographer and I just purchased a Canon R7 and the Tamron SP 35mm f/1.4 DI USD lens. 1. I have read that the lens I am using is super sharp and have seen photos of it that look incredible but I can't seem to produce the same sharpness. I have been trying to learn how to ma...

This is a tandem which I bought at least 20 years ago and it was far from new then. I have absolutely no idea who made it. This badge looks a bit like a bird or perhaps a dragon?

I'm 38 and read this probably between 1993-1997.... when I was between 8-12 years old. I don't think it was a new book at that time. I am trying to track down a book I read as a child. It was about a young boy and girl who auditioned for a local play where they thought the lead actor was Dracula ...